PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe3G294900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 281aa    MW: 32030.3 Da    PI: 4.2983
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe3G294900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox642.1e-2066119356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        k++++t+eq++ Le+ Fe ++++  +++++LAkklgL+ rqV vWFqNrRa++k
  Aqcoe3G294900.1.p  66 KKRRLTSEQVHLLEKSFETENKLEPDRKTQLAKKLGLQPRQVAVWFQNRRARWK 119
                        56789************************************************9 PP

2HD-ZIP_I/II134.83e-4365156192
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        ekkrrl++eqv+lLE+sFe+e+kLep+rK++la++LglqprqvavWFqnrRAR+ktkqlE+dy+ Lk++yd+l+++ + + ke+e+L++e+ 
  Aqcoe3G294900.1.p  65 EKKRRLTSEQVHLLEKSFETENKLEPDRKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDLLKASYDSLRSDYDDIVKENEKLKSEVV 156
                        69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.91261121IPR001356Homeobox domain
SMARTSM003895.0E-2064125IPR001356Homeobox domain
PfamPF000461.4E-1766119IPR001356Homeobox domain
CDDcd000868.88E-1966122No hitNo description
SuperFamilySSF466891.45E-1966131IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-2267128IPR009057Homeodomain-like
PRINTSPR000314.2E-692101IPR000047Helix-turn-helix motif
PROSITE patternPS00027096119IPR017970Homeobox, conserved site
PRINTSPR000314.2E-6101117IPR000047Helix-turn-helix motif
PfamPF021836.5E-19121163IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001558Biological Processregulation of cell growth
GO:0009637Biological Processresponse to blue light
GO:0009651Biological Processresponse to salt stress
GO:0009965Biological Processleaf morphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MDSTTSRLFF DGSCHGNMLL LGSGDPVLRG SRSFINMEDS LKRRPFYSSS DELIEEEFYD  60
EQLPEKKRRL TSEQVHLLEK SFETENKLEP DRKTQLAKKL GLQPRQVAVW FQNRRARWKT  120
KQLERDYDLL KASYDSLRSD YDDIVKENEK LKSEVVSLTG KLQVKEGAGM ELNQISDPPL  180
PTEENVDVTT MQFNVKVEDR LSSGSGVSAV VDEECRQLVD SVDSYFPGDD YGQCIGPVDG  240
VQSEEDDISD DSRSYFSDVF PAAPEQNHQE SETLGWWDWA *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113121RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00323DAPTransfer from AT3G01470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010251293.11e-137PREDICTED: homeobox-leucine zipper protein HAT5-like
RefseqXP_010251294.11e-137PREDICTED: homeobox-leucine zipper protein HAT5-like
SwissprotQ022832e-92HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLA0A061EJ861e-130A0A061EJ86_THECC; Homeobox-leucine zipper protein HAT5
STRINGVIT_14s0066g01440.t011e-116(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-89homeobox 1